}); ;(function($) { "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "AcceptSolutionAction", { Auch per Dauerauftrag oder sogar per Banküberweisung kannst Du deine CallYa Freikarte aufladen. "actions" : [ Oder Ihre })(LITHIUM.jQuery); // Pull in global jQuery reference LITHIUM.Loader.runJsAttached(); { // Set start to true only if the first key in the sequence is pressed { var count = 0; "forceSearchRequestParameterForBlurbBuilder" : "false", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "event" : "RevokeSolutionAction", } "action" : "pulsate" }, ] "event" : "addThreadUserEmailSubscription", Übrigens – zum 01.07.2020 auch bei CallYa: gesenkte Mehrwertsteuer! "useTruncatedSubject" : "true", "accessibility" : false, "action" : "rerender" Ähnliche Themen - guthaben per dauerauftrag Vodafon Prepaid-Card gesperrt trotz Guthaben mikescha , 31.08.2011 , im Forum: Vodafone Prepaid - CallYa count = 0; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/24528","ajaxErrorEventName":"LITHIUM:ajaxError","token":"4URCPOmdsM1PvTuW3S7GNNmfXMHW8Ok8ljKyLBgunOw. "context" : "envParam:quiltName", } Man bekommt hier also eine wirklich komplett kostenlose Simkart… { "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); ] die Gebühr für den von Dir gewählten CallYa-Tarif nicht mehr abgebucht werden kann, wird automatisch neues Guthaben aufgeladen. "revokeMode" : "true", Du bist Dir unsicher, wo Du Dich einloggen sollst? LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); }, } } "displayStyle" : "horizontal", } $('#vodafone-community-header').toggle(); { "event" : "deleteMessage", ] } { "actions" : [ "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", }; "action" : "rerender" "action" : "rerender" }); }, { "context" : "", } "}); ] // enable redirect to login page when "logmein" is typed into the void =) } }, ] } "action" : "addClassName" } $(this).removeAttr('href'); }, { "action" : "rerender" Vodafone CallYa ist das Prepaid-Tarife Angebot von Vodafone Deutschland. Am Anfang des Monats soll immer ein bestimmter betrag aufgeladen werden. "defaultAriaLabel" : "", ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'QGv3cEyMmdG0nqGVOq9-YiE0FkRMmNMgkz-JDoIlxsA. "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-816413 .lia-rating-control-passive', '#form'); $(document).ready(function() { } "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:quiltName,expandedQuiltName", ] } "actions" : [ }, }; "context" : "", if ( key == neededkeys[0] ) { "action" : "rerender" "triggerEvent" : "click", "actions" : [ "actions" : [ ', 'ajax'); { ] { "selector" : "#messageview_0", "actions" : [ // Register the click event handler "parameters" : { Per Dauerauftrag können Sie auch festlegen das ein bestimmter Betrag monatlich auf die Callya Karte aufgeladen wird (gut geeignet bei Kindern) Fazit: Wie Sie in diesem Ratgeber erkennen können sind Prepaid Angebote ernstzunehmende Konkurrenten für Handyverträge und sehr oft die günstigere Lösung für die meisten Anwender. "dialogKey" : "dialogKey" "truncateBody" : "true", Klick hier, um Dich automatisch bei MeinVodafone einzuloggen. lithstudio: [], "action" : "rerender" } "accessibility" : false, "context" : "", "action" : "rerender" LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_6f0c7da46766b0","tooltipContentSelector":"#link_6f0c7da46766b0_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_6f0c7da46766b0_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); ] ] "displaySubject" : "true", "context" : "", "context" : "envParam:feedbackData", "context" : "envParam:quiltName", { "disableLabelLinks" : "false", "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", //if(height > 430) { }, { "action" : "rerender" "event" : "QuickReply", $('#vodafone-community-header .lia-search-toggle').click(function() { }, } else { { { var watching = false; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ;(function($) { auf 16 %. { } if ( watching ) { ] "event" : "ProductAnswer", "revokeMode" : "true", { ] "initiatorDataMatcher" : "data-lia-message-uid" "event" : "MessagesWidgetMessageEdit", Jetzt mit Aufladencode oder Direktaufladung ab 15 €. Dein Internet-Passwort hast Du bei der Registrierung zu MeinVodafone festgelegt. "action" : "rerender" if ( !watching ) { "action" : "rerender" "selector" : "#messageview_0", "kudosable" : "true", "event" : "MessagesWidgetEditAnswerForm", resetMenu(); "context" : "", count = 0; "action" : "addClassName" { }, "accessibility" : false, "action" : "rerender" $('#node-menu li.active').children('ul').show(); }, } "actions" : [ "event" : "ProductAnswerComment", "actions" : [ document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); $('#vodafone-community-header .lia-search-toggle').click(function() { //resetMenu(); } Infos, Weitere Möglichkeiten zur Aufladung findest Du hier im Hilfe-Bereich, 10 GB Datenvolumen für 20 € mit 4G|LTE Max, CallYa Digital kostet 20 Euro für 4 Wochen. "useTruncatedSubject" : "true", $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { Man kann prinzipiell alle Varianten der Aufladung nutzen, die auch für die normale Callya Simkarte von Vodafone zur Verfügung stehen. "}); LITHIUM.Dialog({ "disableLinks" : "false", { "selector" : "#kudosButtonV2_0", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); Und hast ein Kabel- oder TV-Produkt? "disallowZeroCount" : "false", Auf jeden fall muss ich wissen ob, Wenn ich die SMS bekomme das 9,99€ nicht abgebucht werden konnte, Ich dann einen Monat warte und die SMS erneut bekomme "event" : "approveMessage", "useSubjectIcons" : "true", ] "messageViewOptions" : "1111110111111111111110111110100101001101" { ] return; { "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; $(document).keydown(function(e) { LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "disableLinks" : "false", $('#node-menu li.has-sub>a').on('click', function(){ .attr('aria-expanded','false'); "context" : "", } { { { "action" : "rerender" Online Vodafone Prepaid aufladen mit Guthaben Ihrer Wahl. LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); }, Hier gibt's alle Infos. ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_6f0c7da46766b0_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/24528&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", 4G|LTE Max: Durchschnitt laut Connect Test-Ausgabe 01/2020: 78,70 Mbit/s im Download und 29,7 Mbit/s im Upload in Großstädten (Walktest). Hilfe zum Login. }, Audio- und Video-Streaming Dienste sind nicht, oder nur mit erheblichen Einschränkungen nutzbar. Deine individuelle Bandbreite hängt unter anderem von Deinem Standort und der Anzahl gleichzeitiger Nutzer in Deiner Funkzelle ab. Werden die vertraglich zugesicherten Up- und Download-Geschwindigkeiten im deutschen Vodafone-Netz anhaltend oder dauerhaft wiederholt erheblich unterschritten, kann der Kunde eine Beschwerde an Vodafone richten. { "event" : "QuickReply", $('li.close-on-click').on('click',resetMenu); }, Gilt für alle Telekommunikationstarife mit Mindestlaufzeit, Kaufpreise für Geräte und Zubehör sowie Mietentgelte für Geräte. "useSimpleView" : "false", { "initiatorBinding" : true, "displaySubject" : "true", "context" : "", $('.css-menu').removeClass('cssmenu-open') }); LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_6f0c7da46766b0","nodesModel":{"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Archiv_CallYa|forum-board":{"title":"Board-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_6f0c7da46766b0_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); } }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "dialogKey" : "dialogKey" "context" : "envParam:selectedMessage", { }, { { als Handy-Taschengeld Lade CallYa-Karten ganz einfach auf: per Dauerauftrag oder Banküberweisung. }, "event" : "addThreadUserEmailSubscription", notifCount = parseInt($(this).html()) + notifCount; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/24528","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hnH4axFSVjXdOB9vrqh2ASzho4HkuiSQOyARU2IQrRo. } Oktober das Datenvolumen der Tarife CallYa Smartphone Special und CallYa Smartphone Allnet Flat auf 2,5 bzw. { ;(function($) { Eventuell ist die CallYa Komfort-Aufladung auch ne Variante, da erfolgt die Aufbuchung auch automatisch: http://www.vodafone.de/infofaxe/4402.pdf, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_6f0c7da49e5d10', 'disableAutoComplete', '#ajaxfeedback_6f0c7da46766b0_0', 'LITHIUM:ajaxError', {}, 'Sp2Z9R5HEaGJSnw0FyAct45ZWJFUGMGgf7R5ttiHf24. Beispiel: Bei einer Aufladung von 15 Euro schreiben wir dem Kundenkonto 15,38 Euro gut. "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); }, LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_6f0c7da46766b0","nodesModel":{"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Archiv_CallYa|forum-board":{"title":"Board-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_6f0c7da46766b0_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); 5 Gigabyte, das ist 25 Prozent mehr. }); "componentId" : "kudos.widget.button", "displayStyle" : "horizontal", "linkDisabled" : "false" { } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":422,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBAFJXA1wHCxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVRUwMDClIDXhQBBFoFSQEABFdIV18OCk8BUlwAUQEGVwMECwBAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, element.children('ul').slideDown(); { element.siblings('li').find('ul').slideUp(); }, { ] }, })(LITHIUM.jQuery); "event" : "expandMessage", watching = false; }, })(LITHIUM.jQuery); }, })(LITHIUM.jQuery); // Pull in global jQuery reference "action" : "rerender" ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ var element = $(this).parent('li'); "event" : "addThreadUserEmailSubscription", LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "actions" : [ "actions" : [ "event" : "AcceptSolutionAction", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-816415 .lia-rating-control-passive', '#form_0'); }, resetMenu(); { "action" : "rerender" "actions" : [ Execute whatever should happen when entering the right sequence resetMenu(); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:entity", { // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" "context" : "envParam:selectedMessage", "context" : "envParam:quiltName", "useTruncatedSubject" : "true", ] '; "context" : "", Blitzschnelle Abwicklung! } LITHIUM.AjaxSupport.useTickets = false; } "context" : "envParam:quiltName,expandedQuiltName", "event" : "expandMessage", .attr('aria-expanded','true'); "event" : "MessagesWidgetAnswerForm", }; ;(function($) { { } } "actions" : [ "event" : "deleteMessage", B. durch Bilder oder Videos, ist die Nutzung aber deutlich langsamer. Die doppelt anfallenden Kosten der Selbstzahler-Pauschale würde ich mit Kündigung des Sicherheitspaketes kompensieren, welches ich als unnötig erachte und in der Vergangenheit schon die … logmein: [76, 79, 71, 77, 69, 73, 78], { "action" : "rerender" return; }, "event" : "addMessageUserEmailSubscription", } $(this).next().toggle(); "action" : "rerender" }, "useSimpleView" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", }, "kudosLinksDisabled" : "false", }, // Oops, not the right sequence, lets restart from the top. "eventActions" : [ "disallowZeroCount" : "false", ] { { ] LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":816413}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":816415}}]); } "defaultAriaLabel" : "", $('.js-close-header-announcement').on('click', clickHandler); "event" : "MessagesWidgetCommentForm", { "action" : "rerender" })(LITHIUM.jQuery); { Die Bankverbindungen von Vodafone findest Du hier: http://www.vodafone.de/infofaxe/175.pdf Betreff Deine CallYa-Rufnummer und fertig. }); "actions" : [ einen Dauerauftrag einzurichten. "event" : "addMessageUserEmailSubscription", ] ] "event" : "approveMessage", { var handleOpen = function(event) { "parameters" : { Die Geschwindigkeit der Internet-Verbindung können Sie In der MeinVodafone-App überprüfen. ] $('div[class*="-menu-btn"]').removeClass('active'); "event" : "ProductMessageEdit", "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } Wir erkennen Dich eindeutig über das Mobilfunknetz. "event" : "ProductAnswer", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":816415,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "}); : 2508000 BLZ Bist du sicher, dass du fortfahren möchtest? $(this).next().toggle(); ;(function($) { "activecastFullscreen" : false, // just for convenience, you need a login anyways... LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; Es können darüber hinaus kurzfristige Sperrungen eingerichtet sein. } else { window.onload = function() { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "triggerSelector" : ".lia-panel-dialog-trigger-event-click", //}); "actions" : [ } }, "quiltName" : "ForumMessage", $(event.data.selector).removeClass('cssmenu-open'); $('#vodafone-community-header .lia-search-input-wrapper').hide(); }, var position_x = msg.offset(); "action" : "rerender" Oder wähl die Komfort-Aufladung: Sobald Dein verfügbarer Guthabenbetrag unter 5 Euro liegt bzw. }, ] So erhöht Vodafone ab dem 15. { ] Ihr eingesetztes Gerät muss außerdem die technischen Vora… "}); $(this).addClass('active') "eventActions" : [ if ( neededkeys[count] == key ) { } } ;(function($){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); return; }, So kannst Du zahlen: ] "context" : "", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); Den Callya Smartphone Special kann man direkt beim Kauf der Vodafone Prepaidkarte buchen, man kann ihn aber auch nachträglich beispielsweise über die Callya Kontomanager oder über die App. })(LITHIUM.jQuery); { $(document).ready(function() { "message" : "816413", } $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "includeRepliesModerationState" : "false", "displayStyle" : "horizontal", "action" : "rerender" $('.community-menu').removeClass('active') }, "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" //$(window).scroll(function() {